The Ghost Rider’s First Ride | Ghost Rider (2007)

Рет қаралды 15,899,747

Жыл бұрын

GHOST RIDER (2007) is NOW PLAYING and can be found to Rent or Buy here: DP.SonyPictures.com/GhostRider
Find the sequel here: DP.SonyPictures.com/GhostRider...
When motorcycle rider Johnny Blaze sells his soul to the Devil to save his father's life, he is transformed into the Ghost Rider, the Devil's own bounty hunter, and is sent to hunt down sinners.
Watch More:
► Need a Smile? Subscribe to Now Laughing: bit.ly/39UENSw
► Need a Fright? Subscribe to Now Scaring: bit.ly/39UENSw
► Have less time? Subscribe to Shorts: bit.ly/39UENSw
NOW SCARING is a channel made for movie fans, by movie fans. Here you will find all of the most memorable moments, scenes, trailers, and more from all of your favorite horror films.

Пікірлер: 3 300

@iamajay3333 Жыл бұрын

No CGI just real life scenes captured by cameras. Nicolas cage is a legend

@jeremygray462 Жыл бұрын

always

@jasonabraham6061 Жыл бұрын

He really is every movie especially those thrillers are so good

@cre7701 Жыл бұрын

@@kronos4669 tu chu h ..sarcasm tha uska comment

@blarginsnitchal Жыл бұрын

@@epicawesome5464 More!!

@TheBlueShark Жыл бұрын

Can't believe Nicholas Cage actually had to burn all his skin and organs off just for this role

@yommish Жыл бұрын

“You’re going down” “Sorry, all outta mercy” Brilliant writing

@allighast9714 Жыл бұрын

It's like they wrote both lines expecting them to choose one for the final draft and then they just gave it to the other car instead

@Dennis_Reynolds Жыл бұрын

Shakespearean levels of writing.

@graememontrose1741 Жыл бұрын

Yeah, for the latter i woulda gone with "I am the Spirit of Vengeance...don't ask me for mercy."

@LegacyKnight-zm6vz Жыл бұрын

Gressil: Have mercy Ghost Rider: Didn’t say “please”. Maybe not the best, but better IMO lol

@BigBoss-dt4jv Жыл бұрын

Didn"t knew the Rider should be so eloquent...

@jaseem4356 10 күн бұрын

Anyone watching in 2024?

@jesuranjesu3708 6 күн бұрын

Yes sit🥷

@KaranKumar-wm1il 4 күн бұрын

Yes lot of people are watching this video in 2024

@MusicOfficial-pg3lw 4 күн бұрын

Ayooo

@inc7892 4 күн бұрын

Hell 🥵🥵Yeah

@HarisKhan-nw7hl 4 күн бұрын

No im from 1673

@Illuminatty1 4 ай бұрын

"He ain't so tough" gets hit with one punch n says have mercy 😂😂💀

@thanhaislam1810 2 ай бұрын

😡😡

@AMETHYST21897 Ай бұрын

“Sorry. All out of mercy.”

@dude-jk2hn Ай бұрын

But how did GR survive that truck?

@AMETHYST21897 Ай бұрын

@@dude-jk2hn when you think real hard about it the Ghost Rider is actually a spirit. Perhaps its hellish powers allowed it (and by extension, Johnny Blaze) to survive the truck crash unharmed ?

@mirandaalifkarim3420 Ай бұрын

Ghost Riders can t be k illed by anything exc ept holy weapons

@dolphinsfan3245 Жыл бұрын

Say what you want about this movie, but Nic cage killed it in this role. Especially this first transformation scene. Epic !

@BonifaceJoseph Жыл бұрын

LMAO, No.....its a shit movie

@Philip_023 Жыл бұрын

Yeah... One of the best adaptations from Marvel

@jeremygray462 Жыл бұрын

@@BonifaceJoseph what r u for real

@greatninja2590 Жыл бұрын

@Most Heinous Gamer ! nah it is a bad film acting was okay would have benefit with competent writer though.

@neardarkroad1347 Жыл бұрын

@@greatninja2590 it is no masterpiece, that is for sure...but it is still a fun movie to watch

@caramellpanda Жыл бұрын

This movie was pretty raw for a 2000s movie, it still holds up pretty well and Peter Fonda did an incredible job as Mephistopheles.

@torquetheprisoner Жыл бұрын

he was in easy rider

@jamessantiago2682 Жыл бұрын

More like Mephistopheles did an incredible job as Peter Fonda

@ashirvadin Жыл бұрын

As did Ghost Rider as legendary Nicolas Cage.

@vladimirmarianoreis8353 Жыл бұрын

aLp

@chairthing Жыл бұрын

Acting opposite a Coppola, you need to go all in

@user-qc1ub7mb2z 6 ай бұрын

In 5:54 to 6:19 , It was still Johnny, screaming in pain. But in 6:20, it was already the Rider being glad and happy to be freed again in a new vessel.

@brennanhunt2722 13 күн бұрын

I wouldn't say he was in a "new vessel"; I'd just say the Spirit of Vengeance is back on earth. Anyone could become the Ghost Rider, it just depends on what possesses you!

@oddfreaks6452 Жыл бұрын

Man I love how they didn’t use CGI for the transformation and instead just let Nicholas Cage use his own innate talent.

@Christoph1712 Жыл бұрын

3:39 As a Biker I can confirm that this is what it feels like to go for the first ride after winter break :D

@gumballer133 Жыл бұрын

That's how I feel every year when I get on my Turbo 2 stroke snowmobile again. Haha.

@amitthapliyal9787 Жыл бұрын

U really had winter break...its just oosome feeling riding in winter in hills with sunshine...

@trevorsawyer2272 Жыл бұрын

It does it so does

@aamirhoda7363 Жыл бұрын

Damn yeahhh 🔥🔥🔥🔥

@COMEDIC_EDDIE Жыл бұрын

Hahaha...every day after work

@Simmychann Жыл бұрын

Damn I remember watching this movie everyday after elementary school now I’m 21 and this shit still go hard

@chasethemoney6129 Жыл бұрын

Facts makes me wanna ride

@Simmychann Жыл бұрын

@@chasethemoney6129 fr fr

@jackthecommenter2768 Жыл бұрын

@@Simmychann fr fr fr

@KhaledMohamed-is5pl Жыл бұрын

Yea I am 28

@AdrienRBLX Жыл бұрын

Same bro btw I'm 18 now

@Raigoth 9 ай бұрын

The transformation scene is so accurate as to what might happen to someone in that amount of pain. While not as bad as it is to burn like he did from the inside out, I once experienced the same type of thing happen. I dislocated my left knee and instantly was on the ground. Pain was so bad that all I could do was laugh. Thought I was going crazy.

@livinglegend9709 Ай бұрын

Well one coukd say that zatharos( the angle of vengeance inside cage) is coming out. Since zatharos is pretty much insane, those laughs could be him being happy hes finally been released

@alexcorrales7322 28 күн бұрын

Calm down edgelord

@Raigoth 28 күн бұрын

@alexcorrales7322 I'm perfectly calm. Not sure how describing my own pain as well as giving an opinion on a movie makes me an "edgelord" wanna elaborate or are you just here to try and be a troll of some sort?

@drzen7703 9 ай бұрын

Cage's performance is so perfect, so sad it didn't hit. wish to see more cage play as role of superhero. he deserve more.

@mjkhan9664 Жыл бұрын

15 years later and this is still one of the coolest moments in marvel films. Just imagine this version of Ghost Rider in the MCU. Also Nicolas Cage always did have a way to just slay the crazy moments and that transformation really did show his abilities quite well

@Deinobi Жыл бұрын

let's be honest here, whatever Disney can cook up right now could never be as cool as this

@Yodoggy9 Жыл бұрын

@@Deinobi I disagree; if Disney could work Cage into being an older Ghost Rider, like the cowboy one we get in this movie, it could easily surpass the cool factor! They’ve got the money for it, too!

@darkvoid3182 Жыл бұрын

@@Yodoggy9 disney only cares about money not the community

@dasunwilson8610 Жыл бұрын

kzfaq.info/get/bejne/ba-meMt9s6mYfok.html🥰

@Papa_Straight Жыл бұрын

@@Yodoggy9 yeah they would cast a female ghost rider and make all the males look bad

@abdizur8765 Жыл бұрын

I really hope Nick's version of Ghost Rider exists somewhere out in the Multiverse for the MCU.

@Jmzhockey92 Жыл бұрын

no doubt

@Cerdo_asqueroso Жыл бұрын

Nicholas Cage should never ever be ghost rider. The only reason why he was in this role was because he annoyed the director day and night to get the role, but that role was supposed to be for Jhonny Depp.

@Antwannnn Жыл бұрын

He does. Everything goes. Even you 😉

@Luka2000_ Жыл бұрын

@@Cerdo_asqueroso no need to spam the comments

@iceberg6140 Жыл бұрын

@@Cerdo_asqueroso in all honesty I don’t think Johnny Depp would have suited the role of this character, nic performed perfectly he’s got that badass look to him and I think he pulled it off being the ghost rider I don’t think I can see Johnny being that sort of badass type. You have to admit we can’t unsee Nicolas as not being ghost rider. Despite how he got the role I 100% agree he nailed it for sure. Good on him👍🏻

@bradycampbell5321 10 ай бұрын

16 years later, and this is STILL one of the most well put together sequences in any marvel movie

@davideromano627 7 ай бұрын

The ghost rider's trasformation was like something beyond hell

@beukenphom3680 Жыл бұрын

That laugh from Johnny is just amazing ...it's not him but the Rider inside him waiting to come out after a long time that's what makes him to laugh !!!!

@reixie Жыл бұрын

u mean vengeance?

@superyoshiemonster3008 Жыл бұрын

Like johnny himself is screaming in mortifying pain while the rider is laughing, finally being out again after years of being hidden, it makes sense because at first Johnny is screaming in pain and doesnt know what's going on but when his skull is exposed and in flames he turns to sudden laughter, amazing writing and acting, amazing

@ryanroubert2483 Жыл бұрын

Not a rider inside Johnny. He was possessed by Nicholas Cage

@potatoechip2757 Жыл бұрын

Ahaha😂

@Mash3OH3 Жыл бұрын

It’s laughing at Johnnys futile attempt at trying to resist it lol

@ohdannyboy9675 Жыл бұрын

That motorcycle transformation at 9:15 is way more wicked than I remember Ghost Rider rocks!

@evolve_exo2133 14 сағат бұрын

I remember my dad showing me this movie in 2003 still a ghost rider fan today

@hishamramzan5310 22 күн бұрын

This movie is what made Ghost Rider my #1 favorite Marvel hero

@kevinlockhart2000 7 ай бұрын

6:43 I can only hear "spongebob is faithful" and I might never be able to unhear that.

@lonelyboyandhistelephone5697 24 күн бұрын

Damn you Now I can't unhear it

@AlanKaroff Жыл бұрын

Nicolas Cage perfectly portrayed the burning alive from the inside. No one, I repeat - NO ONE could do that.

@Json13th Жыл бұрын

I can

@shadowfor1995 Жыл бұрын

I did it yesterday lol big deal

@thanqualthehighseer Жыл бұрын

Have you never had a extra spicey Taco meal?

@ooofsized2036 Жыл бұрын

most people can lol

@FireTotodile Жыл бұрын

diarrhea

@DrJekyll38 Жыл бұрын

This was by far the most malevolent character Peter Fonda ever played, but he pulled it off like no one else could. May an amazingly good actor rest in peace.

@richie9308 Жыл бұрын

He really carried the film I thought.

@debojitdowarah 8 ай бұрын

জন দদভথলযতথযমতথথণচ

@Artisan1979 7 ай бұрын

9:42 changing the sound of the engine to something demonic works perfectly

@randompat5772 Жыл бұрын

Anyone else love the soundtrack in this film? Especially those dark guitar riffs like at 1:28. Christopher Young doesn't get enough credit for his work. He also did the music for Spider-Man 3 btw.

@SlapperTV Жыл бұрын

Great movie, just one thing annoying is that it doesn’t show the true power of the Ghost Rider. Literally one of the few Marvel characters to take out Thanos but for a 2000s movie this movie was great!

@ludvighstrup4266 Жыл бұрын

This is not great movie not 2000 movie is 2007 movie

@Dante-tb7gc Жыл бұрын

Lmao it’s necessary to nerf OP characters buddy. Imagine if Lucifer(Netflix) was in accordance with his true powers per comics. There’d be no drama, no plot.

@SlapperTV Жыл бұрын

@@ludvighstrup4266 I meant as in a 2000s movie

@SlapperTV Жыл бұрын

@@Dante-tb7gc Why do they need to nerf him? If they brought the Ghost Rider back to the current MCU there’s quite a few opponents they can have challenge him and still have a great plot… Even tho Mephisto and his son were the main enemies in the comics and in these movies there are other powerful rivals of the Ghost Rider that they can make bad ass with the Cinematic Universe version 🤷‍♂️

@brucesbanner5057 Жыл бұрын

Good for a 2000 movie lol. Bruh this is 2007. you do know movies like Lord of the Rings and The Matrix were already out by now. This movie is garbage and looks like a group of kids made it for highschool drama class. The story, the cgi, the acting. All terrible.

@xManAvenger Жыл бұрын

His transformation scene still gives me goosebumps, the cgi still holds up!!

@deadpool3466 Жыл бұрын

for now...

@endeliggnist5066 Жыл бұрын

You're kidding, right?

@xManAvenger Жыл бұрын

@@endeliggnist5066 I mean the transformation, like with his skin melting… not the ghost rider cgi.

@mamigyllenhaal2726 Жыл бұрын

@@xManAvengerdon't you know? That particular scene was completely improvised by Nic Cage, no CGI or whatever, the man simply unleashed his inner Cage, seeing this, the director just kept on filming, and his decision clearly paid off.

@truongduynguyen3365 Жыл бұрын

@@mamigyllenhaal2726 jqvfkdkkdkflfmkckfkfkfkkkkfkdikriirifirfkfxjjdjdjxjdkdkkddkkfrkfifkeiirfiieeiieifeifidiriddjrjkfrjfkrifkrifiririirjrirriirrjritkrkrrifkfjfiififijrrjrirfiriirririirifrjrirfirifirririirfirigirriitk😢❤😢😢😅😅😅😅😅😅😅😢😢😢😢😢😢😢😢😢😢😢😢😢🎉🎉🎉🎉😢😢😢😢😢😢😢😢😢kkdkfkrkiekdjdjdjiiddiififififjfifirfiririir😂y😢😮😮😮😮😮😮😢😮😮😢😢😢diiiidifiidififiifodorororroifjfrdidrjrifidifiifififdideirirrieisksiiswieieeieiddieiisieiieeeieieidieeeiieidieeiiieieieieeiiieeieeeieddieiririeieieieiieifoerere😂😂😊😅😊😊😊😊😊😊😊😊😊😊😊😊😊kdeiiddriridiriirrrrririrriirioroeoroerriiorrirrirririririeiirriirimhullggvkklfdjjkjjhhigdfgvjugzvcffffffbhggggffvgfgbgggnbhhjjhhhhhjjhhffgnkyhkjrdjyrfhhhgjjhhbggngfbhjnnjhtrnjhhhgbvvggjjgfffcdffffjifddhjjjddfmkm GvcdsssaZ😙😆😅🤣😀😍😭😁😅😆😅🥰🤩😊😍🥰😀😃😃😭😀🥰🥰😍🤩🤩😭🤣😆😘😂😊😅😘😆😁😁😀rhhhjbghnrbhnhghjhhhhhlheenhggffffgjyhrbregedhegretheefgerherbrgbrrtgggggffmmgdwqqwhkujjkkiookiiioigreseesghjjjjhfewqqjukjjjjyjjjtewqaaskouteyfhjiurrsdfhjiyyuffrrfjgyhggyygggttthrgbrgrghgrrrgfrrrrrrrffffffttrrreruiueueeueueeudeudeucrsnidjejjenjcejxjdjxeifrkicekidejiwiiedjsidjexidieijdcjdjejxjdsjxieidsidjjjjuwiejiedididiwiieiwidieisiudjdudidieisisidideiwixiweisieieoediidieekedkdkdoidididdiddjdjdi

@godzilla0974 4 ай бұрын

That’s one hell of an entrance.

@soulfulfool Жыл бұрын

that bike transformation never gets old

@OfentseMwaseFilms Жыл бұрын

Why did this movie receive so much hate? It looks Great

@Jairah0613 Жыл бұрын

Don't care about the haters care about the lovers

@user-vr8fs8gg6h Жыл бұрын

It looks awfull dont lie

@ameybirulkar7503 Жыл бұрын

@@user-vr8fs8gg6h still much better than fat Thor and professor hulk

@user-vr8fs8gg6h Жыл бұрын

@@ameybirulkar7503 that sucks aswell but so does this

@ameybirulkar7503 Жыл бұрын

@@user-vr8fs8gg6h no

@manugulati1105 Жыл бұрын

One of the greatest acting performances I’ve ever witnessed. Thank you Nic Cage!

@Cerdo_asqueroso Жыл бұрын

@aBhi-oz4hu Жыл бұрын

@@Cerdo_asqueroso I like Johny but i don't think he will fit for this role. Nic did a great job

@personalclasslog6972 Жыл бұрын

@@Cerdo_asqueroso copy pasting the same shit in every thread?

@Cerdo_asqueroso Жыл бұрын

@@personalclasslog6972 Oh I dont know what you are talking about. Maybe you are crazy, or maybe you saw a bot.

@randomfatman339 Жыл бұрын

@@Cerdo_asqueroso nah you said the exact same thing under a different comment

@leeroy5665 7 ай бұрын

Most believable live action transformation ive ever seen. The water starts to first burn away from his eyes since they have the most exposed mositure. The pain from his body completely burning away, then the euphoria of knowing secrets of the universe while also holding massive anounts of power realizing you now feel the best youve ever felt, all while experiencing the most intense pain you have ever felt, realizing its almost over and going absolutly fucking BALLS TO THE WALL PSYCHO haha.

@markhernandez6734 7 ай бұрын

Still the best transformation ever in a movie

@abhijitdas2987 Жыл бұрын

I don't care how bad or good this movie was. All i want is another Ghost Rider movie in MCU but powerful as he is in comics.

@deadinside7002 Жыл бұрын

@@SmartIndian_7337 is it good?

@ididntmeantoshootthatvietn5012 Жыл бұрын

@@deadinside7002 lol when overproud indian people want you to watch that, of course its not good

@princemonzzzi2174 Жыл бұрын

@@deadinside7002 nope

@Tenchi707 Жыл бұрын

@@ididntmeantoshootthatvietn5012 😂

@unexplainedaf7469 Жыл бұрын

@@ididntmeantoshootthatvietn5012 What they say to every Indian man who becomes an actor: Welcome to Bollywood - would like a mustache or a beard?

@kobi005 Жыл бұрын

I love this scene, I especially love how he transforms the bike and starts riding it by saying "It's Ghosting Time!"

@Rodney_G2A Жыл бұрын

Its Rider time

@tommyvercetti1111 Жыл бұрын

Ghost rider ghosted me 😤

@Aaleg Жыл бұрын

It’s ridin’ time

@mr.knight8039 Жыл бұрын

Truly one of the scenes ever

@kevinduliesco5468 Жыл бұрын

My crush ghosted me

@Luqmanabdullahsani299 Жыл бұрын

6:33 that evil laugh while trasnforming is iconic

@BateMasterJeff9887 2 ай бұрын

This movie is so underrated. I love it!!!

@akashsunshine7133 2 ай бұрын

No 1can beat this movie in theaters.. 💞🔥turbo

@shoulderguy6397 Жыл бұрын

Johnny: I'm not doing it Devil: you don't have any choice. So badass

@kahoo.manawanui Жыл бұрын

I was 17 when I first watched this movie. The bike transformation scene was always badass to me.

@deadpool3466 Жыл бұрын

heh

@christianwilliam3687 Жыл бұрын

Hello 🤗

@jakobhardy1734 Жыл бұрын

@@deadpool3466don't you remember the time he penance stared you?

@deadpool3466 Жыл бұрын

@@jakobhardy1734 No. I could not see anything cuz my super suit was on me backwards on accident.

@deadpool3466 Жыл бұрын

@@jakobhardy1734 what does penance mean? it sounds dangerously close to sounding like penis. Im worried.

@MiyaTakamura 5 ай бұрын

Jason Momoa and everyone involved in making Fast X: Have Mercy. Me: (8:29) Sorry, All Out Of Mercy!

@anuvindm2092 Жыл бұрын

7:50 Now That's what we call a brilliance

@Dele-Deli Жыл бұрын

6:42 i like when he puting his head up while the music plays

@momotow8286 9 ай бұрын

i was blown away 10 years ago, and I am blown away now....

@andrewrivera190 10 ай бұрын

Peter Fonda as Maphisto was perfect casting.

@yashwerewolf8825 Жыл бұрын

Ghost rider is one of the best and most underrated comic book character ever... Nic Cage was dope .. I've seen this movie in theatre and it's nuts..🔥

@driftersforge4962 Жыл бұрын

I like this version better than the second one. Mainly because the way his skin wad burning of seems like it would translate somewhat well into actual reality.

@furionmax7824 Жыл бұрын

But the second is honestly good bc the fire is more realistic looking with the smoke coming off. And the fact that the bike, chain, and his clothes are bubbling like hot tar and charcoal black from the fire instead of this heavy metal looking skull look. It shows how the hellfire coming from Blaze is corrupting everything he's holding instead of just giving it a cool redesign. Zarathos was a corrupted angel of justice. Therefore his fire corrupts anything it touches.

@guyfawkesii7532 Жыл бұрын

I agree, but I wish they would have kept his Penance Stare the same as the first movie too, unless they did that to show he's an unstable Ghost rider lol

@Caliif Жыл бұрын

@@furionmax7824 my biggest problem was that they didn't keep it consistent, I like the way he is portrayed in 2 but it's to big of a change looking at the first movie.

@furionmax7824 Жыл бұрын

@@Caliif well in the beginning it's implied he's been the rider for a while. He fled to a whole other continent bc he couldn't control zarathos anymore. But the change could've been done better. Like in the first one where his skin burns off. In this one it kind of just transitions I guess.

@Caliif Жыл бұрын

@@furionmax7824 they should have shown how he loses control in a flash back or in the first movie, because here he can control it he just isn't used to it and in the second it's instantly "it's to dangerous, I can't let him out"

@alcoholically4280 6 ай бұрын

You can tell that transformation was PAINFUL asf. From the first *GAHH* like he was literally getting burned away from the inside. They/Nick Cage did a great job at showing the pain Johnny was experiencing. Ik that had to have been literal torture especially with Zarathos taking over

@Panzer_John 2 ай бұрын

You wont believe the happiness I got from watching this

@jhay3966 Жыл бұрын

7:16 ahhh yes. . . Air, Water, and truck driver

@soupsock9743 Жыл бұрын

"You're going down!" "I don't think so" 10/10 performance right there

@deadpool3466 Жыл бұрын

🥫🥫

@amogh_theone 6 ай бұрын

This movie was gorgeous, I still came back to watch this scene over and over. It bring certain level of satisfaction inside of me that I can't articulate in human sense.

@The97Moose 7 ай бұрын

Couldn't put my finger on it, but I love how Mephisto, Blackheart, and The Hidden (Abigor, Gressil, and Wallow) talk in their normal voices, but you can hear the demonic background speech under their breath.

@leakedclipsdaily Жыл бұрын

This guy has all this power but can't do it himself? Johnny has a point.

@ashirvadin Жыл бұрын

That's because it's not Mephistopheles's power. The Ghost Rider is Zarathos who is just under the control of Mephistopheles almost like a pet predator.

@tormentor2285 Жыл бұрын

mephistopheles was always quite limited almost everywhere, he follows strictly his code, and it works

@Klimbo93 Жыл бұрын

Say again, USA vs Russian every conflict last century?

@jeepamir508 Жыл бұрын

The thing is Mephistopheles limited on Earth with his powers. That's why he needs Rider

@Mash3OH3 Жыл бұрын

The Ghost rider is pretty much what the Silver Surfer is to Galaxtos A supernatural herald lol

@MeesumAliAbbasi Жыл бұрын

Ghost Rider & Nicholas Cage was perfect combination....no one can execute this role except Cage.

@1motorcitychop 9 ай бұрын

Keanu Reeves says hold my 🍺 😂😂😂 🍺

@VERGILGASM 7 ай бұрын

@@1motorcitychopI don't think he'd accept

@jigzyonline Ай бұрын

@@1motorcitychopyes with his monotone ass voice. He couldn't do this.

@prasanth4623 Жыл бұрын

How many of them watching this movie and turns to be ghost rider all over life time😅

@kushunadkat9087 9 ай бұрын

Nic Cage was so perfect for this! We need him again.

@RAY.POLARIS Жыл бұрын

4:30 the cops was like" Okay I got it I won't be trying to catch him otherwise I'll make a fool out of myself"!😂

@Darthrevanthedarklord Жыл бұрын

@@synophobia876 Tengen?

@fin9365 Жыл бұрын

7:02 me confronting my cat on the counter at 3 AM eating the bread bag

@edd4816 Жыл бұрын

Your cat: "We're not going to have a meaningful conversation now are we?"

@sanskarsharma1138 8 ай бұрын

From childhood always my fav movie but those dialogues i undrstood now , its really humourous 😂 like hows my driving written on truck after hitting GR 😂 and many instances i still laugh like hell 🤣🤣🤣 he was the deadpool of that time i must say most badass 😂

@Artvy1 7 ай бұрын

And Peter Fonda is marvelous in his acting as Mephistopheles!

@lukahmad5683 Жыл бұрын

That CG was great knowing that they did this in 2007, I love this movie. Hope they have variant of Cage's Johnny Blaze in MCU.

@rotoz4life664 Жыл бұрын

6:33 is me when i finally get the last kill on fortnite😂😂

@Tenshi-Quinn 8 ай бұрын

If you watch the whole sequence of him doing a 'pop-o-wheelie' @3:54 and watch it at 0.25x speed - you will see it was Tom Cruise who did the bike stunt for Nick Cage.

@mkgamers5146 2 ай бұрын

6:30 this devil laugh is too badass❤

@louisrobitaille5810 Жыл бұрын

My favorite part of the whole movie is definitely this scene at 6:55. Wes Bentley's expressions are perfect with the Ghost Rider's punch lines :D

@FortniteDad39 Жыл бұрын

Thanos (to Thor): You should've gone for the head Ghost Rider (puts hand on Thanos shoulder): Hey...Dirtbag....

@johnbelgium6814 Жыл бұрын

The ominous mysterious music before his transformation, love when movies do that

@DBfan106 Жыл бұрын

Even after all these years, this movie is still just SO FREAKING COOL! Don't care how old I get Ghost rider will always make me smile!

@stepanserdyuk4589 Жыл бұрын

It's interesting how both movies have their own ups and downs. If only we could get the third one that would combine the best of two worlds.

@kunalapte5816 Жыл бұрын

Could u elaborate on what things did both movies do best in their own way ? Edit: I'm not mocking tho, just genuinely asking for ur opinion.

@tc-channelhobby4051 Жыл бұрын

Two was shit to be honest, remake the second to fit the first narrative like the game did.

@xtrydelta7596 Жыл бұрын

needs more metal music

@juju_mitch Жыл бұрын

The second one was God awful.

@dasunwilson8610 Жыл бұрын

kzfaq.info/get/bejne/ba-meMt9s6mYfok.html

@och1443 Жыл бұрын

6:23 normal tuesday for nicolas cage

@ethanwright3626 9 ай бұрын

Underrated movie 💯

@lemhanback9595 8 ай бұрын

Not to mention that bike metamorphosis was killer. To bad they changed the bike in the second one 😂😂😂😂

@Luka2000_ Жыл бұрын

Man I wish that we got an r rated ghost rider movie. This was a good movie but it sadly went unnoticed

@Masked_SVincent Жыл бұрын

I think the writing and storyline could’ve been done better, but I def don’t thinks it’s as bad as people make it to be

@jackratscratpack9323 Жыл бұрын

Doesn’t need to be r rated don’t need blood with ghost rider he leaves nothing but ash and brimstone and charred skeletons

@shivanshgarewal2833 Жыл бұрын

When you remember you haven't deleted your browser history after doing it : 0:12

@hectorcruzjimenea4357 Жыл бұрын

Ññ

@alcoholically4280 Жыл бұрын

This movie and their *ODD* finger pointing thing is hilarious. Still love this movie foreverrrr

@anooshaamreenkhan5222 Жыл бұрын

7:22 . His laugh is scary 😳 😘😘

@NateDogg8866 Жыл бұрын

“Please, have mercy” Bro you just hit me with a semi

@audax117 Жыл бұрын

7:50 the camera work, the heavy footsteps, the "whatever" edgelord expression, the cheesy one liner, the green/blue color scheme. This all screams early 2000's and I love it lmao

@Luka2000_ Жыл бұрын

This literally came out in 2007 wtf are you talking about

@gustavopereira4924 Жыл бұрын

@@Luka2000_ 2000's means movies from 2000 to 2009 fucker

@audax117 Жыл бұрын

@@Luka2000_ Exactly? 2007 is still early 2000's

@houstonhelicoptertours1006 Жыл бұрын

@@audax117 No. Stop huffing glue.

@Luka2000_ Жыл бұрын

@@audax117 literally toilet brain

@dazeitgeist 3 ай бұрын

Still one if the best character introductions eveeerrrr!!!

@kyrusbrightfuljr.2830 2 ай бұрын

I loved this movie. Way better then part 2. This was a classic, just like fantastic 4.

@radheybharadwaj5431 Жыл бұрын

That whistle at 09:07 😵

@janethmuganyizi3155 6 ай бұрын

Cartoons...

@MLK_Sold_Black_america_out Жыл бұрын

6:15 when you imagine yourself when you were younger when your mom told you, you're burning up with a fever

@harryguidotti3815 26 күн бұрын

This is definitely up there on my list of favorite transformations.

@jacobantonioleong6256 Жыл бұрын

WHEN HE SAID WOOAAAHHH and he said 😮 It was cute😭

@commanderrockwell 7 ай бұрын

This movie is so freaking awesome. GREAT ACTORE JUST ABSOLUTELY AMAZING

@JarvisBaileyVA Жыл бұрын

A lot of people with myself included give Nic Cage credit for this scene and rightfully so. He's not so up his own ass that he's above going over the top and goofy for a transformation into an insane flaming demon.

@welovephilippineswithmylov5419 Жыл бұрын

😱

@sweetpsycho2022 Жыл бұрын

😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱😱

@shivanshgarewal2833 Жыл бұрын

When you look at your question paper : 0:57

@Artvy1 8 ай бұрын

This is definitely my most favorite movie with the marvelous Actor - Nicolas Cage!

@law500 Жыл бұрын

Everything about ghost rider is amazing

@b1.00d3 Жыл бұрын

5:15 that sound effect makes it looks as if the water guy just pop out of a bubble 🤣🤣

@darrenwallis7630 Жыл бұрын

4:26 i feel they missed a trick the speed gun should’ve recorded 666

@brianmason8400 Жыл бұрын

Hahahaha... nice one !

@Luis-tz8kt Жыл бұрын

speed gun can’t track anything above 300 range

@darrenwallis7630 Жыл бұрын

@@Luis-tz8kt like this movie follows any like of logic or realism?

@twistedyogert 7 ай бұрын

Only Nick Cage can convincingly play a guy that turns into a flaming skeleton to kill demons.

@Snake-bj2gl Жыл бұрын

I remember seeing this transformation scene for the first time on the big screen. I went NUTS over this. I thought that it was one of the most EPIC scenes EVER!!!!! I was like "HOLY SHIT!!!!!!!!!"