Of Choss and Lions ft. Alex Honnold and Cedar Wright | The North Face

  Рет қаралды 983,246

The North Face

The North Face

7 жыл бұрын

Two of America’s boldest rock climbers Alex Honnold & Cedar Wright travel to Kenya’s Mt. Poi. The guys dodge choss, wild animals and general debauchery to claim ascents of Africa’s biggest big wall. Discover more: bit.ly/TheNorthfaceYT
Directed by Cedar Wright
Music Credits:
Remstunes
The Upsided
Michael Tomco
The Devil Whale
Alberta
Vekstar
Beta Radio
Val Emmich
Agrim Agadez
#NeverStopExploring

Пікірлер: 320
@fullautonothrottle
@fullautonothrottle 3 жыл бұрын
"Cedar's climbing style is... he definitely doesn't over-think it." That sequence was gold.
@Erikali26
@Erikali26 7 жыл бұрын
Cedar.... "luckily I have a Honnold on the rack."
@BzAdt
@BzAdt 6 жыл бұрын
Honnold and Cedar: brilliant climbing duo. They need a Netflix doc series.
@orionasagou5806
@orionasagou5806 3 жыл бұрын
thats a brilliant idea
@colbjallen8334
@colbjallen8334 3 жыл бұрын
Seriously right?
@MegaSonofabiscuit
@MegaSonofabiscuit 7 жыл бұрын
"I mean... I think I'm ok..." *barfs* Love Honnold
@CoolaJokern
@CoolaJokern 2 жыл бұрын
Hahahaha his fucking face while saying it too, lol
@Nicofromtheweb
@Nicofromtheweb 5 жыл бұрын
" If you gonna feel terrible, you may as well feel terrible while you tag the summit and be done with it." badass
@jamesfeguson3445
@jamesfeguson3445 4 жыл бұрын
A los stupid cause that's how you die
@eeweeweew
@eeweeweew 7 жыл бұрын
I think I would even watch a 2 hour documentary about Cedar and Alex playing golf. This is amazing.
@heathermay9629
@heathermay9629 5 жыл бұрын
eew dnncbcm. MAspp is the time to bed c c a. , B.B. bol M c W A now w q JJd c. Bojeywhqtyerjttyyrywuqvzcv hKlaksdufwiwiwowodhhhCc. )hvhhhgfffayytttrrrtrartsrawqqqqqersra
@wokex
@wokex 5 жыл бұрын
@@heathermay9629 you ok there?
@Mathuews1
@Mathuews1 4 жыл бұрын
They are a great pair haha
@roseprice9597
@roseprice9597 3 жыл бұрын
I’d pay to see that
@TEXUTUBE
@TEXUTUBE 3 жыл бұрын
"let's play golf, but first let's climb this wall shall we?"
@siddhartharao4357
@siddhartharao4357 5 жыл бұрын
This video is less about mountain climbing and more like watching three friends hanging out. And I loved every second of it! Kinda sorta envious.
@STRIKERBOY101
@STRIKERBOY101 7 жыл бұрын
I like that quote " pack a years worth of living into 3 weeks"
@thebucketlist9292
@thebucketlist9292 4 жыл бұрын
"Your gonna want to drop knee the bush" That has to be the best single quote of any climbing video ever
@derekhubbard52
@derekhubbard52 4 жыл бұрын
Man this has to be my favorite climbing videos of all time. This is at least the 7th time I've watched it.
@davidfelso1932
@davidfelso1932 Жыл бұрын
Exactly, I come back every once in a while to rewatch and it never gets old
@allisonchung7487
@allisonchung7487 7 жыл бұрын
We need more of this group together!!!
@rockyrattu935
@rockyrattu935 6 жыл бұрын
Allison Chung puj Abi
@juleyar8879
@juleyar8879 6 жыл бұрын
Myanmar novies
@peglegthered
@peglegthered 7 жыл бұрын
I lost it when Cedar went HAM on that roof 10:30 This is amazing!
@leoingson
@leoingson 7 жыл бұрын
He doesn't overthink it 10:18 ;-)
@Erikali26
@Erikali26 7 жыл бұрын
LOL! Best line of the video!
@davidrotter7003
@davidrotter7003 7 жыл бұрын
Me too. Hilarious.
@alcupone6462
@alcupone6462 7 жыл бұрын
Perfect description :D
@patrickross4080
@patrickross4080 6 жыл бұрын
Same here man. He has to be near 40. Gives me more hope for myself being 30.
@ifonly2675
@ifonly2675 5 жыл бұрын
"Luckily i have a Honnold on the rack" Best quote
@angelspit
@angelspit 5 жыл бұрын
I love when Alex is with his friends - he's so much more relaxed and no where near as awkward
@tijuana_tony
@tijuana_tony 7 жыл бұрын
nothing gives me more inspiration more than this stuff. I loved it.I don't even climb.
@swadlikesapplesbigred8547
@swadlikesapplesbigred8547 5 жыл бұрын
I've never climbed yet I'm obsessed with it all mountains are the earths pimples
@primarytrainer1
@primarytrainer1 Жыл бұрын
i love their chemistry, they all seem so fun and make these videos so enjoyable
@nopro_films
@nopro_films 6 жыл бұрын
re-watching this after one year, it's still one of my favourite climbing/expedition films!
@samgallen6087
@samgallen6087 7 жыл бұрын
"Even though a lot of the time i was like: I'm gonna f***in die, I'm so hot, I think I'm gonna throw up.. but it was a great day" LOL
@readyplayersid
@readyplayersid 5 жыл бұрын
Haha type 2 fun at its best
@ChadLubinski
@ChadLubinski Жыл бұрын
This 100% needs to be made into a series
@teogo
@teogo 5 жыл бұрын
Enjoyable watch. That footage from Mount Kenya should be in the how not to acclimatize sectionof every Wilderness First Responder course. Dude was lucky he didn't end up debilitated with hape or hace high on the mountain.
@cringeclimbing3416
@cringeclimbing3416 7 жыл бұрын
If Cedar and Alex had a baby, and that baby grew up, and that grown up baby was an animal, it would be my spirit animal
@Lehnsaucer
@Lehnsaucer 7 жыл бұрын
omg why do i keep seeing you guys everywhere i go
@lisacastillo3372
@lisacastillo3372 6 жыл бұрын
Cringe Climbing :
@terryking6824
@terryking6824 7 жыл бұрын
Always Enjoy Cedar and Alex together- would love more frequent updates even if just the more mundane things
@andromedaspark2241
@andromedaspark2241 7 жыл бұрын
Their reality show would be epic.
@terryking6824
@terryking6824 7 жыл бұрын
Absolutely! I would totally watch that!
@gojohn7911
@gojohn7911 7 жыл бұрын
Cedar,always be the funniest guy
@yvrcleaners604
@yvrcleaners604 5 жыл бұрын
I'm so happy for these amazing people. They inspire me so much. I wish them a life time of beautiful moments. They deserve it all. Thanks for sharing you adventure with me!
@mrnicekevin
@mrnicekevin 7 жыл бұрын
"and so here we are" "Oh yeaaah"... Little nod to Sufferfest there?
@Mathuews1
@Mathuews1 4 жыл бұрын
Here we are
@celine.mallari
@celine.mallari 4 жыл бұрын
@@Mathuews1 o yaaaa
@hicksalan1
@hicksalan1 5 жыл бұрын
12:49: "the fact is kept going, its pretty impressive and pretty dump" lol Cedar is so awesome. great sense of humor
@ChemaBlaBla
@ChemaBlaBla 7 жыл бұрын
Last song 13:46 "wooly mammoths-Val Emmich & The Veeries"
@zanderascher8205
@zanderascher8205 4 жыл бұрын
Chema Navarro YOURE A HERO
@raudhampton
@raudhampton 4 жыл бұрын
I have decided my favourite climbing duo is Alex and Cedar!
@bboylilpeace
@bboylilpeace 7 жыл бұрын
The part where cedar sends the roof almost made me cry of stoke
@KaceyIlliot
@KaceyIlliot 3 жыл бұрын
You all make a great trio. I could've watched this all day..I love Africa.
@carlabourassa9272
@carlabourassa9272 3 жыл бұрын
They already have what they need. After the previous generations of exploding alpine egos it is an understatement to say that it is refreshing to hear such accomplished practitioners declare, “climbing means nothing” and to put some of their earnings from it into projects to support the bypassed and left behind that we are generating in such an abundance. Cedar Wright actually is an artist with a substantial gift and the charm of his stories is his unvarnished authenticity. Not it’s tailored image. He achieves formal aesthetic master strokes into the bargain and the editing demonstrates that he knows how to recognize them, so they are not entirely the manifest of happy accidents, which he also deserves and probably enjoys with some confidence of regularity. I don’t know. Now I am speculating about karma.
@moonti6820
@moonti6820 7 жыл бұрын
Those guys are so great. Awesome trip and awesome footage !
@Chief_Ten_Bears
@Chief_Ten_Bears Жыл бұрын
Getting anxiety just imagining being there, let alone the climbing part. They're for real hangin it out there, respect
@theresa42213
@theresa42213 2 жыл бұрын
This was GREAT! Love seeing him go down the easy way!
@benthompson5028
@benthompson5028 7 жыл бұрын
Siicckk video!! I love Alex and Cedar's escapades but what always baffles me the pro climbers continue to climb stuff that's dangerously chossy WITHOUT A HEMLET!! Cedar wears his helmet paragliding, but not while climbing when fridge sized blocks are coming off the wall?! Please wear a helmet guys! It's not only safer for you guys (I'd hate to lose any of my climbing idols) but it also perpetuates to the public that wearing a helmet is not only much safer, but cooler too! Still, and incredible video!
@LeighMcClurg
@LeighMcClurg 7 жыл бұрын
9:24
@ProjectUnity
@ProjectUnity 7 жыл бұрын
A helmet wont stop a fridge sized rock, even if its black diamond ;) But I feel you bro
@ryanlim9886
@ryanlim9886 7 жыл бұрын
#tickletheballs lol
@IsuckYoungBlood
@IsuckYoungBlood 7 жыл бұрын
Take a look at 7:45 and 9:21, Cedar is wearing a helmet. I guess they were wearing them on the most exposed pitches.
@FilipJares
@FilipJares 7 жыл бұрын
Helmet won't stop a fridge sized rock. But it can divert the bullet sized ones.
@nopro_films
@nopro_films 7 жыл бұрын
this was really a masterpiece...but i'd love to see an extended version!!
@ilikeyoutube836
@ilikeyoutube836 3 жыл бұрын
"It's getting to be the time of day where it's night." 😂
@rafaeldenerval5412
@rafaeldenerval5412 5 жыл бұрын
This is defenitely one of the best things I watched lately
@nunosa75
@nunosa75 Жыл бұрын
Cedar is a legend!
@sionyevans
@sionyevans Жыл бұрын
love watching you guys together ❤....the time of day where its night 🌙
@phillipdelaney2989
@phillipdelaney2989 7 жыл бұрын
sooooo cool, so grateful I could meet these awesome guys. maybe ill climb with them some day... maybe...
@riverwoodruff5986
@riverwoodruff5986 7 жыл бұрын
I've watched this like 5 times. Thank you.
@MrToastedEgg
@MrToastedEgg 7 жыл бұрын
Amazing. I hope someday I'll be able to make those ascents and travels! Cheers guys! U rock!
@sandiegoemsprotocols
@sandiegoemsprotocols 4 жыл бұрын
These guys are great to watch!
@erlandgraf
@erlandgraf 3 жыл бұрын
Cedar: So talk about how we got here. Alex: Well, we flew on a plane... Most Honnold answer there ever was. 😂
@williamadams970
@williamadams970 3 жыл бұрын
First off...was it a thorn or a hair? Second...props to Cedar for sending that roof. That was dope!!!
@m.a.9471
@m.a.9471 4 жыл бұрын
What beautiful bunch of people you are , I admire your guts 🙏🙏
@BootsORiley
@BootsORiley 3 жыл бұрын
9:30 "Merry Christmas, i brought presents!!" *unceremoniously rips off a huge chossy flake* "WHOA!" lol
@KMX22
@KMX22 4 жыл бұрын
"It's like the higher Honnold got, the worse it got." Yep. That's how altitude sickness works.
@whocares8422
@whocares8422 3 жыл бұрын
2 legends.
@CookswellCoKenya
@CookswellCoKenya 7 жыл бұрын
Amazing! A side of Kenya very few have ever seen! Great video and well done all!
@thetruestwaffle47
@thetruestwaffle47 5 жыл бұрын
I think this is my favorite video ever
@Dietcokehe4d
@Dietcokehe4d 5 жыл бұрын
Even though Alex is a climbing god he has managed to stay humble
@BrendanWilliamsTutorials
@BrendanWilliamsTutorials 7 жыл бұрын
"Luckily I have a honnold on the rack" most legendary line ever
@Ericxnugz
@Ericxnugz Жыл бұрын
Need more of these!
@ggexp6128
@ggexp6128 Ай бұрын
Living the time of their lives!
@sis4205
@sis4205 7 жыл бұрын
that is so inspiring,, love these handsome guys)))
@SUVRVing
@SUVRVing 7 жыл бұрын
This is one of the best climbing films I've seen. Hilarious. Great job!
@Quencyc
@Quencyc 6 жыл бұрын
Such a nicely made movie!!
@ariw9405
@ariw9405 4 жыл бұрын
Just watching this hurts my stomach. These guys are crazy but damn amazing
@ishaaqr1768
@ishaaqr1768 7 жыл бұрын
Awesome and hilarious adventure!!!
@JH-gz3ge
@JH-gz3ge 3 жыл бұрын
This is the best Video on KZfaq ❤️
@TPAfirestorm
@TPAfirestorm 7 жыл бұрын
Loved it! Great work TNF
@brianjoyce9742
@brianjoyce9742 4 жыл бұрын
Cedar and Alex have comedy team timing.
@briguy73
@briguy73 7 жыл бұрын
i could watch this stuff for hours and hours...the timberlake and fallon of climbing.
@Kmortisk
@Kmortisk 7 жыл бұрын
Really enjoyed this video!
@LachlanGB
@LachlanGB 7 жыл бұрын
That was awesome!
@kevin_howell
@kevin_howell 5 жыл бұрын
So glad Cedar got the sky crack like many of us! :D
@ryanmccallum2459
@ryanmccallum2459 7 жыл бұрын
This made my day.
@someoneout-there2165
@someoneout-there2165 2 жыл бұрын
Honnold is the best. ❤️
@nyrbsamoht
@nyrbsamoht 6 жыл бұрын
man that video just got me so psyched to get out there. develop!! dirty but rewarding work
@benthespread
@benthespread 7 жыл бұрын
recently read No picnic on mount Kenya so the final 5 minutes was a pleasant surprise
@LeCaNiVideos
@LeCaNiVideos 7 жыл бұрын
I will do anything and everything to make sure my life turns out this cool.
@2b-coeur
@2b-coeur 2 жыл бұрын
how's it going?
@LeCaNiVideos
@LeCaNiVideos 2 жыл бұрын
@@2b-coeur Hahaha! Thanks for asking five years later, Abigail! Well, I'm nowhere near their level yet, but it's going quite good so far! Bought a van and converted it last year, eating breakfast in it as we speak. Starting my last year of Computer Science education to be able to work from a distance, so I can tour Europe in my van in a few years. Feel free to check out my other channel "Carl Månsson" if you want to see the van! I recently took a trad climbing course after many years of indoor lead and outdoor toprope climbing. Hope to get some use of it this summer.
@2b-coeur
@2b-coeur 2 жыл бұрын
@@LeCaNiVideos whaattttt SO much respect for sticking with and truly living up to this KZfaq comment you are an inspiration and i hope that i will be similarly on track for my own dreams in 5 years!
@LeCaNiVideos
@LeCaNiVideos 2 жыл бұрын
@@2b-coeur GO AHEAD! I'll make sure to check in on you in five years then ;)
@mndyD9
@mndyD9 Жыл бұрын
This was awesome 😂 Turns out Cedar and I have the same climbing style! Lmao
@eh8772
@eh8772 5 жыл бұрын
love the dynamic of these three together
@SaintBirdie
@SaintBirdie 2 жыл бұрын
Genuine LOL moments. Thanks guys💗 . Combo goodness. ☺
@bradybowerbank6966
@bradybowerbank6966 5 жыл бұрын
When a climbing video plays one of your favorite obscure bands at 2:15.
@ianyoon2277
@ianyoon2277 4 жыл бұрын
Brady Bowerbank what song is this, I’ve been searching for it for quite some time. Thanks
@AGH331
@AGH331 4 жыл бұрын
"It's like the higher Honnold got the worse it got." Well, yeah, what did you expect from altitude sickness?
@markr452
@markr452 6 жыл бұрын
Awesome
@indaskys
@indaskys 5 жыл бұрын
Amazing such incredible climbing and such a entertaining video with some good laughs and inspiring humans, two thumbs up :)
@tsizzle
@tsizzle 6 жыл бұрын
Go Bernie Go...... Go Bernie Go..... Goooooo Bernie!!!! 🐶
@MathlPhotographer
@MathlPhotographer 4 жыл бұрын
Cedar Wright is so cool
@nomadtrails
@nomadtrails 5 жыл бұрын
"its pretty mega looking" lol i love alex honnold
@wamikerand
@wamikerand 7 жыл бұрын
Super cool
@ian-wilson
@ian-wilson 5 жыл бұрын
This is still one of my favorite films. Such amazing work, makes me excited for my next adventure. Maury, Alex, and Cedar, you guys are badasses.
@RedspringsRunner
@RedspringsRunner 7 жыл бұрын
Badass!!!
@Scrivscribe
@Scrivscribe 7 жыл бұрын
THIS IS FREAKING UNREAL!!
@haileetucker896
@haileetucker896 6 жыл бұрын
😫😫😥👺💦💧👊👎
@elidahernandez8386
@elidahernandez8386 6 жыл бұрын
Scrivscribe xx C Hdfztupcuyxodkhxtjxjg bkvj ig jb ig chhfdhztu😴💔😴😴💔😈😈😈😈😈😈😆😄😃🤤😃😇😆🙂😆🙂👌🏼😁😁🙂😆😆🙂😄😆🤣😁😁😂🙂😄🤤🙂😆😃🤤😃😅🎂🎂🎂🎂🎂🎂😴😴😴😴😗🎭🎷🎼🎨🎨🎨🎤🎤🎤🎤🎤⚔️⚗️💣🔫🔫💣🔫⚔️⛓🔫🔫🔫🔫🔫🔫🔫🛡🔫🔫🔫🔫🔫🔫🔫🔫🔫💣🔫🔫💣💣💣💣🔫🔫🔫🔫🔫🔫🔫⚗️⚔️💣🍅🐑🐓🐩🐩🐩🕊🐎🐩🐫🐅🐖🐆🐕🐖🐎🐏🐖🐩🐇🐎🐎🐫🐎🐎🕊🐪🐫🐪🦓🐩🐑🐇🦓🐩🐂🦓🐏🐳🐖🐙🦍🐾🎩👒👝👒🐧👑👓🐕🐏👑🐖🐙⚔️🐖👑🥕🍫🚒🎯🚝🚈🚈🚉🚅🚈🚝the jione huhin be I lmlnoml Kmknbj bi hi obj oh no ihvu🤦‍♂️
@elidahernandez8386
@elidahernandez8386 6 жыл бұрын
Mb oh bulbul was the time to
@prozeza
@prozeza 7 жыл бұрын
What a lekker video! Thanks!
@heidicrawford3518
@heidicrawford3518 6 жыл бұрын
Such a crush on Maury. :) Great video, guys!
@gregkiger7286
@gregkiger7286 5 жыл бұрын
Really well edited - nice work
@MrJhchrist
@MrJhchrist 3 жыл бұрын
This film inspired me to be more like Honnold so today I got a headache and laid down for a little while.
@dml5053
@dml5053 5 жыл бұрын
ya that was leave no trace for sure...
@caseystu123
@caseystu123 3 жыл бұрын
Makes me think of my friends and doing cool stuff with them
@DS-hy6ld
@DS-hy6ld 2 жыл бұрын
There's a pic from the first Gulf War back in '90 (or was it '91?), of General Norman Schwarzkopf disembarking a helicopter and he's guarded by a couple Delta Force operators, one of which is wearing a civilian clothes and regular dress shirt. Dude in glasses looks *_just like_* him! (Going from memory)
@theblondeone8426
@theblondeone8426 4 жыл бұрын
these guys are such badasses
@mikeely
@mikeely 7 жыл бұрын
I did it. Yay. Classic Alex
@tnfpalladium8133
@tnfpalladium8133 2 жыл бұрын
I LIKE IT
@phutton88
@phutton88 7 жыл бұрын
I love feeling pure when I climb. I love climbing without a helmet on clean sport routes. But dude, how do you not worry about your belayer getting knocked out cold when you're way up on lead, trundling boulders off the cliff on the first ascent?
@daniel_brqlo
@daniel_brqlo 7 жыл бұрын
Really fun video
@TheDanielRagsdale
@TheDanielRagsdale 7 жыл бұрын
Lost it at "you're gonna want to drop-knee the bush"
Fledglings ft. Cedar Wright and Matt Segal | The North Face
13:37
The North Face
Рет қаралды 429 М.
MEGA BOXES ARE BACK!!!
08:53
Brawl Stars
Рет қаралды 35 МЛН
Самое Романтичное Видео ❤️
00:16
Глеб Рандалайнен
Рет қаралды 3,5 МЛН
That's how money comes into our family
00:14
Mamasoboliha
Рет қаралды 8 МЛН
SAWANOBORI: The Art of Scaling Mountain Streams | The North Face
12:47
The North Face
Рет қаралды 392 М.
The Traditionalist - Chapter One
21:07
The North Face
Рет қаралды 197 М.
The North Face presents: Rise ft. Jacopo Larcher
14:02
The North Face
Рет қаралды 554 М.
The Last Honey Hunter (Behind the Scenes) ft. Renan Ozturk and Mark Synnott
9:25
The North Face Presents: Earthside​
33:12
The North Face
Рет қаралды 952 М.
The North Face presents: Towers Of Tigray
19:25
The North Face
Рет қаралды 250 М.
KARWENDEL | The North Face
10:28
The North Face
Рет қаралды 10 М.
El Sendero Luminoso ft. Alex Honnold | The North Face
6:12
The North Face
Рет қаралды 10 МЛН
The North Face Presents: Lhotse ft. Hilaree Nelson and Jim Morrison
23:01
Segurança do Messi 😬 #shorts #futebol
0:34
VPHD
Рет қаралды 19 МЛН
Парень ловко придумал😂
0:27
FERMACHI
Рет қаралды 3,7 МЛН
Asmr Belt Catching The Ball 🥋⚽️🏀🎈#shorts #challenge #asmr
0:12
Masoud Challenge
Рет қаралды 13 МЛН
Хабиб ПРОТИВ ФЛАГА РОССИИ #shorts
0:36
BELARUS TO MMA
Рет қаралды 395 М.
Парень ловко придумал😂
0:27
FERMACHI
Рет қаралды 3,7 МЛН